From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000893 [new locus tag: EGJ38_RS04460 ]
  • pan locus tag?: SAUPAN003029000
  • symbol: EGJ38_000893
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000893
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000893 [new locus tag: EGJ38_RS04460 ]
  • symbol: EGJ38_000893
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 891995..892105
  • length: 111
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422865 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    GTGATGACAACCAATTACTATGTTGAATCTATAAAATTAAAATTGAATTTCATTATGAAT
    ATCGATATAATGAATTGTAAAAAACAAATTTTAAAACGTATTTTATATTGA
    60
    111

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000893 [new locus tag: EGJ38_RS04460 ]
  • symbol: EGJ38_000893
  • description: hypothetical protein
  • length: 36
  • theoretical pI: 10.0165
  • theoretical MW: 4428.44
  • GRAVY: 0.130556

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6512
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.3485
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.097096
    • TAT(Tat/SPI): 0.002873
    • LIPO(Sec/SPII): 0.02013
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422865 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MMTTNYYVESIKLKLNFIMNIDIMNCKKQILKRILY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: GraR (repression) regulon
    GraR(response regulator)important in cationic antimicrobial peptide (CAMP) resistance;  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Mélanie Falord, Ulrike Mäder, Aurélia Hiron, Michel Débarbouillé, Tarek Msadek
    Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways.
    PLoS One: 2011, 6(7);e21323
    [PubMed:21765893] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]