Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000964 [new locus tag: EGJ38_RS04815 ]
- pan locus tag?: SAUPAN003176000
- symbol: EGJ38_000964
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000964
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000964 [new locus tag: EGJ38_RS04815 ]
- symbol: EGJ38_000964
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 969545..969892
- length: 348
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422935 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCGTTTATATATTAATGAAATTAAAATTAAAGATGACATACTTTATTGTTATACAGAA
GATTCTATTAAAGGATTATCTGAAGTAGGACAAATGCTCGTTGATAGTGATAATTATGCC
TTTGCGTATACATTAGATGATGGTAAAGCGTATGCTTATCTCATTTTCGTACAAGAAACA
TGGACGATGTTGCATGAAAACATGACTAAAAAAATTATTATCAATGATGAACTAGAATTG
ACTGAATTCCACCAAGAACTTACTTATATTTTAGACAATATAAAAGGGAATAATAATTAT
GGTAAGGAATTTGTTGCAACCGTTGAAGAAACATTCGACATTGAATAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000964 [new locus tag: EGJ38_RS04815 ]
- symbol: EGJ38_000964
- description: hypothetical protein
- length: 115
- theoretical pI: 3.99629
- theoretical MW: 13529.2
- GRAVY: -0.3
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined UPF0738; Family of unknown function (UPF0738) (PF19785; HMM-score: 107.8)and 1 moreRNase_H (CL0219) TNP-like_RNaseH_N; TNP-like, RNase H N-terminal domain (PF21787; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5162
- Cytoplasmic Membrane Score: 0.0941
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3895
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007708
- TAT(Tat/SPI): 0.000137
- LIPO(Sec/SPII): 0.00071
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422935 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQETWTMLHENMTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000964 > relQ > ppnK > EGJ38_000967 > mgtE > cpaA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)