From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001049 [new locus tag: EGJ38_RS05240 ]
  • pan locus tag?: SAUPAN003305000
  • symbol: nrdH
  • pan gene symbol?: —
  • synonym:
  • alternate name: JSNZ_001049
  • product: glutaredoxin-like protein NrdH

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001049 [new locus tag: EGJ38_RS05240 ]
  • symbol: nrdH
  • product: glutaredoxin-like protein NrdH
  • replicon: chromosome
  • strand: -
  • coordinates: 1054436..1054669
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423018 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCAGAAATAATCGTTTATACGCAGAATGATTGCCCACCTTGTACATTTGTAAAAAAT
    TATCTTAATGAGCATCAAATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGA
    AACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGTAATCCA
    ATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA
    60
    120
    180
    234


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_001049 [new locus tag: EGJ38_RS05240 ]
  • symbol: NrdH
  • description: glutaredoxin-like protein NrdH
  • length: 77
  • theoretical pI: 3.96455
  • theoretical MW: 9187.19
  • GRAVY: -0.546753

⊟Function[edit | edit source]

  • TIGRFAM:
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 45.7)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 37)
    and 6 more
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 29.8)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 25.4)
    glutaredoxin-family domain (TIGR02190; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 19.2)
    glutaredoxin (TIGR02180; HMM-score: 17)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 40.2)
    and 3 more
    GST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 19.3)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 17.3)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 12.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9895
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0096
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002137
    • TAT(Tat/SPI): 0.000092
    • LIPO(Sec/SPII): 0.000503
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423018 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSEIIVYTQNDCPPCTFVKNYLNEHQIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=EGJ38_001049&oldid=114975"