From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
  • pan locus tag?: SAUPAN003313000
  • symbol: rpoY
  • pan gene symbol?: rpoY
  • synonym:
  • alternate name: JSNZ_001054
  • product: DNA-dependent RNA polymerase subunit epsilon

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
  • symbol: rpoY
  • product: DNA-dependent RNA polymerase subunit epsilon
  • replicon: chromosome
  • strand: -
  • coordinates: 1060085..1060303
  • length: 219
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423023 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGTATTTAAAGTTTTTTATCAACATAACAGAGACGAGGTAATTGTGCGTGAAAAT
    ACACAATCACTTTATGTTGAAGCTCAAACAGAAGAACAAGTACGTCGTTACTTGAAAGAT
    CGTAATTTTAATATCGAATTTATCACTAAATTAGAGGGCGCACATTTAGATTACGAAAAA
    GAAAACTCAGAACACTTTAATGTGGAGATTGCTAAATAA
    60
    120
    180
    219


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
  • symbol: RpoY
  • description: DNA-dependent RNA polymerase subunit epsilon
  • length: 72
  • theoretical pI: 5.13421
  • theoretical MW: 8751.68
  • GRAVY: -0.822222

Function[edit | edit source]

  • reaction:
    EC 2.7.7.6?  ExPASy
    DNA-directed RNA polymerase Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1)
  • TIGRFAM:
    isopropylmalate/isohomocitrate dehydrogenases (TIGR02088; HMM-score: 15.5)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined RpoY; RNA polymerase epsilon subunit (PF07288; HMM-score: 96)
    and 4 more
    DUF4275; Domain of unknown function (DUF4275) (PF14101; HMM-score: 17.6)
    Img2; Mitochondrial large subunit ribosomal protein (Img2) (PF05046; HMM-score: 13.8)
    HTH (CL0123) RecX_HTH1; RecX, first three-helix domain (PF21982; HMM-score: 13.6)
    SH3 (CL0010) DUF5776; Domain of unknown function (DUF5776) (PF19087; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8515
    • Cytoplasmic Membrane Score: 0.0476
    • Cell wall & surface Score: 0.0032
    • Extracellular Score: 0.0977
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002653
    • TAT(Tat/SPI): 0.000273
    • LIPO(Sec/SPII): 0.000322
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423023 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAVFKVFYQHNRDEVIVRENTQSLYVEAQTEEQVRRYLKDRNFNIEFITKLEGAHLDYEKENSEHFNVEIAK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]