Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
- pan locus tag?: SAUPAN003313000
- symbol: rpoY
- pan gene symbol?: rpoY
- synonym:
- alternate name: JSNZ_001054
- product: DNA-dependent RNA polymerase subunit epsilon
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
- symbol: rpoY
- product: DNA-dependent RNA polymerase subunit epsilon
- replicon: chromosome
- strand: -
- coordinates: 1060085..1060303
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423023 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCAGTATTTAAAGTTTTTTATCAACATAACAGAGACGAGGTAATTGTGCGTGAAAAT
ACACAATCACTTTATGTTGAAGCTCAAACAGAAGAACAAGTACGTCGTTACTTGAAAGAT
CGTAATTTTAATATCGAATTTATCACTAAATTAGAGGGCGCACATTTAGATTACGAAAAA
GAAAACTCAGAACACTTTAATGTGGAGATTGCTAAATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001054 [new locus tag: EGJ38_RS05265 ]
- symbol: RpoY
- description: DNA-dependent RNA polymerase subunit epsilon
- length: 72
- theoretical pI: 5.13421
- theoretical MW: 8751.68
- GRAVY: -0.822222
⊟Function[edit | edit source]
- reaction: EC 2.7.7.6? ExPASyDNA-directed RNA polymerase Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1)
- TIGRFAM: isopropylmalate/isohomocitrate dehydrogenases (TIGR02088; HMM-score: 15.5)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined RpoY; RNA polymerase epsilon subunit (PF07288; HMM-score: 96)and 4 moreDUF4275; Domain of unknown function (DUF4275) (PF14101; HMM-score: 17.6)Img2; Mitochondrial large subunit ribosomal protein (Img2) (PF05046; HMM-score: 13.8)HTH (CL0123) RecX_HTH1; RecX, first three-helix domain (PF21982; HMM-score: 13.6)SH3 (CL0010) DUF5776; Domain of unknown function (DUF5776) (PF19087; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8515
- Cytoplasmic Membrane Score: 0.0476
- Cell wall & surface Score: 0.0032
- Extracellular Score: 0.0977
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002653
- TAT(Tat/SPI): 0.000273
- LIPO(Sec/SPII): 0.000322
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423023 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAVFKVFYQHNRDEVIVRENTQSLYVEAQTEEQVRRYLKDRNFNIEFITKLEGAHLDYEKENSEHFNVEIAK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : rnjA < rpoY < EGJ38_001055
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)