Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001106 [new locus tag: EGJ38_RS05525 ]
- pan locus tag?: SAUPAN003379000
- symbol: zapA
- pan gene symbol?: zapA
- synonym:
- alternate name: JSNZ_001106
- product: cell division protein ZapA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001106 [new locus tag: EGJ38_RS05525 ]
- symbol: zapA
- product: cell division protein ZapA
- replicon: chromosome
- strand: +
- coordinates: 1110906..1111172
- length: 267
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423075 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCACAGTTTAAAAACAAGGTAAATGTATCAATTAATGATCAGCTTTTTACAATTGTT
GGGGAAGATAACCCAGAGCACATACGATATGTAGCACATTTAGTTGATGATAAAATAAAA
GAATTAGGGTATAAAGCAGCAGGTTTAGATACTTCAAGAAAAGCAATACTAACTGCTGTG
AATATTATGCATGAAAAAGTACTACTAGAAGAAGAAAATCGACGTTTGAAACAACAAATT
CACAAATTGCAGCAGCGTGAGCAATAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001106 [new locus tag: EGJ38_RS05525 ]
- symbol: ZapA
- description: cell division protein ZapA
- length: 88
- theoretical pI: 9.00732
- theoretical MW: 10250.7
- GRAVY: -0.627273
⊟Function[edit | edit source]
- TIGRFAM: Central intermediary metabolism Other methionine adenosyltransferase (TIGR01034; EC 2.5.1.6; HMM-score: 13.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined ZapA; Cell division protein ZapA (PF05164; HMM-score: 60.5)and 2 moreYicC-like_C; Endoribonuclease YicC-like, C-terminal (PF08340; HMM-score: 16.1)S-AdoMet_synt_N; S-adenosylmethionine synthetase, N-terminal domain (PF00438; HMM-score: 14.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9914
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0068
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001949
- TAT(Tat/SPI): 0.00009
- LIPO(Sec/SPII): 0.000267
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423075 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAQFKNKVNVSINDQLFTIVGEDNPEHIRYVAHLVDDKIKELGYKAAGLDTSRKAILTAVNIMHEKVLLEEENRRLKQQIHKLQQREQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : zapA > EGJ38_001107
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)