From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
  • pan locus tag?: SAUPAN003627000
  • symbol: EGJ38_001281
  • pan gene symbol?: —
  • synonym:
  • alternate name: JSNZ_001281
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
  • symbol: EGJ38_001281
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1299258..1299455
  • length: 198
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423246 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATTGCTATGATGAAATATTCAATACAATCAAAAAGTTGATAGAAAACAAAGAGATA
    TCGAGTTATCAAATTAATAAAGATACTGGGATAAGTTACGGTAATATTAATGCTATGCGC
    CGTGGAGAAAGAAGAATAGAAAATTTAAGCTTAAAGAATTCAAAAATCTTATATGAATAT
    GCGAAAAAGGTATTATAA
    60
    120
    180
    198


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
  • symbol: EGJ38_001281
  • description: hypothetical protein
  • length: 65
  • theoretical pI: 9.72877
  • theoretical MW: 7676.8
  • GRAVY: -0.698462

⊟Function[edit | edit source]

  • TIGRFAM:
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 16.3)
  • TheSEED: data available for COL, NCTC8325
  • PFAM:
    HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.3)
    HTH_60; Helix-turn-helix domain (PF20317; HMM-score: 20.8)
    and 1 more
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7583
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.2416
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.019503
    • TAT(Tat/SPI): 0.001036
    • LIPO(Sec/SPII): 0.003167
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423246 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNCYDEIFNTIKKLIENKEISSYQINKDTGISYGNINAMRRGERRIENLSLKNSKILYEYAKKVL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]