Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001285 [new locus tag: EGJ38_RS06420 ]
- pan locus tag?: SAUPAN003635000
- symbol: EGJ38_001285
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001285
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001285 [new locus tag: EGJ38_RS06420 ]
- symbol: EGJ38_001285
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1302104..1302289
- length: 186
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423250 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCAGAATACAAGAAAAAGATAATTGAATTAATTGAAAGTAATTTAACAGGATATGAA
ATTTCTAAAAAAACTGGAGTTTCTCAATATGTACTTTCACAATTAAGACAGGGCAAACGC
GAAGTAGATAATCTAACCCTGAATACAACAGAAAAATTATATGAATATGCCAATAAAGTT
TTGTAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001285 [new locus tag: EGJ38_RS06420 ]
- symbol: EGJ38_001285
- description: hypothetical protein
- length: 61
- theoretical pI: 9.39889
- theoretical MW: 7100.1
- GRAVY: -0.639344
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 16.6)HTH_3; Helix-turn-helix (PF01381; HMM-score: 15.1)HTH_11; HTH domain (PF08279; HMM-score: 14.2)and 2 moreno clan defined Endotoxin_N; delta endotoxin, N-terminal domain (PF03945; HMM-score: 12.9)HTH (CL0123) Dimerisation2-like_dom; Dimerisation2-like domain (PF21212; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8773
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.1214
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011002
- TAT(Tat/SPI): 0.000421
- LIPO(Sec/SPII): 0.001575
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423250 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]