Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001294 [new locus tag: EGJ38_RS06465 ]
- pan locus tag?: SAUPAN003656000
- symbol: EGJ38_001294
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001294
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001294 [new locus tag: EGJ38_RS06465 ]
- symbol: EGJ38_001294
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1305999..1306211
- length: 213
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423259 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAGAAAAATGAAAGTAATATTACTGACGTAACTCAGAACGAAGAGCAACTAGACAAC
AGTGATGAACAATCACAACAGAATGAGAAAACATTTTCTCAAGAAGAAGTATCACAATTG
ATTAAAGAGCGTATAGCTAGAGAACGCAAAAAATCAGATGAACATATTAAAGATGCAGTT
CAAGAAGCTGAGAAGTTAGCTAAAATGAAGTAG60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001294 [new locus tag: EGJ38_RS06465 ]
- symbol: EGJ38_001294
- description: hypothetical protein
- length: 70
- theoretical pI: 4.47678
- theoretical MW: 8235.92
- GRAVY: -1.59143
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Other phosphonate metabolism protein PhnM (TIGR02318; HMM-score: 10.8)
- TheSEED:
- PFAM: no clan defined DUF4355; Capsid assembly scaffolding protein Gp46 (PF14265; HMM-score: 24.3)and 3 moreSOGA1-2-like_CC; SOGA 1/2-like, coiled-coil (PF14818; HMM-score: 11.9)Spore_II_R; Stage II sporulation protein R (spore_II_R) (PF09551; HMM-score: 9.1)S5 (CL0329) EFL1; Elongation factor-like GTPase 1-like domain (PF25118; HMM-score: 8.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9941
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0018
- Extracellular Score: 0.0039
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004716
- TAT(Tat/SPI): 0.002017
- LIPO(Sec/SPII): 0.001642
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423259 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEKNESNITDVTQNEEQLDNSDEQSQQNEKTFSQEEVSQLIKERIARERKKSDEHIKDAVQEAEKLAKMK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001293 > EGJ38_001294
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)