Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001296 [new locus tag: EGJ38_RS06470 ]
- pan locus tag?: SAUPAN003658000
- symbol: EGJ38_001296
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001296
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001296 [new locus tag: EGJ38_RS06470 ]
- symbol: EGJ38_001296
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1306613..1306735
- length: 123
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423261 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTCAATTCAACAATTAGATGGTTACATTTCTATAGAAGATTTTTTTAAGCATATGGAT
GAATTATCGAAGAAAGAAGAATTAGAAAAAGAAATTAATCAATCAAAGTCTAAATATCAA
TAG60
120
123
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001296 [new locus tag: EGJ38_RS06470 ]
- symbol: EGJ38_001296
- description: hypothetical protein
- length: 40
- theoretical pI: 4.60512
- theoretical MW: 4838.41
- GRAVY: -1.095
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: SH3 (CL0010) MTR4_beta-barrel; Mtr4-like, beta-barrel domain (PF13234; HMM-score: 13.7)Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 2.03
- Cytoplasmic Membrane Score: 0.06
- Cellwall Score: 0.56
- Extracellular Score: 7.34
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8086
- Cytoplasmic Membrane Score: 0.0059
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1854
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.03
- TAT(Tat/SPI): 0.005371
- LIPO(Sec/SPII): 0.006643
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423261 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSIQQLDGYISIEDFFKHMDELSKKEELEKEINQSKSKYQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001295 > EGJ38_001296
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)