Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
- pan locus tag?: SAUPAN003934000
- symbol: hup
- pan gene symbol?: hup
- synonym:
- alternate name: JSNZ_001457
- product: HU family DNA-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
- symbol: hup
- product: HU family DNA-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1503652..1503924
- length: 273
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423417 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAACAAAACAGATTTAATCAATGCAGTTGCAGAGCAAGCTGATTTAACTAAAAAAGAA
GCTGGTTCAGCAGTAGATGCTGTATTCGAATCAATCCAAAACTCACTTGCTAAAGGTGAA
AAAGTACAATTAATTGGTTTCGGTAACTTTGAGGTACGTGAACGTGCTGCACGTAAAGGT
CGTAACCCTCAAACTGGTAAAGAAATTGATATCCCAGCAAGTAAAGTTCCAGCATTCAAA
GCTGGTAAAGCATTAAAAGATGCTGTAAAATAA60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
- symbol: Hup
- description: HU family DNA-binding protein
- length: 90
- theoretical pI: 10.3214
- theoretical MW: 9625.94
- GRAVY: -0.466667
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair integration host factor, beta subunit (TIGR00988; HMM-score: 85.5)DNA metabolism DNA replication, recombination, and repair integration host factor, alpha subunit (TIGR00987; HMM-score: 80.7)and 1 moreDNA metabolism Chromosome-associated proteins putative DNA-binding protein (TIGR01201; HMM-score: 22.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 129.2)and 7 moreHU-HIG; HU domain fused to wHTH, Ig, or Glycine-rich motif (PF18291; HMM-score: 27.5)HU-CCDC81_bac_2; CCDC81-like prokaryotic HU domain 2 (PF18175; HMM-score: 23)HU-CCDC81_euk_2; CCDC81 eukaryotic HU domain 2 (PF18289; HMM-score: 17.8)no clan defined DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 17.1)IHF-likeDNA-bdg (CL0548) HU-CCDC81_euk_1; CCDC81 eukaryotic HU domain 1 (PF14908; HMM-score: 13.5)no clan defined DUF2780; Protein of unknown function VcgC/VcgE (DUF2780) (PF11075; HMM-score: 12.6)Glycos_trans_3N; Glycosyl transferase family, helical bundle domain (PF02885; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9891
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0108
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006571
- TAT(Tat/SPI): 0.001468
- LIPO(Sec/SPII): 0.001013
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423417 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]