From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
  • pan locus tag?: SAUPAN003934000
  • symbol: hup
  • pan gene symbol?: hup
  • synonym:
  • alternate name: JSNZ_001457
  • product: HU family DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
  • symbol: hup
  • product: HU family DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1503652..1503924
  • length: 273
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423417 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAACAAAACAGATTTAATCAATGCAGTTGCAGAGCAAGCTGATTTAACTAAAAAAGAA
    GCTGGTTCAGCAGTAGATGCTGTATTCGAATCAATCCAAAACTCACTTGCTAAAGGTGAA
    AAAGTACAATTAATTGGTTTCGGTAACTTTGAGGTACGTGAACGTGCTGCACGTAAAGGT
    CGTAACCCTCAAACTGGTAAAGAAATTGATATCCCAGCAAGTAAAGTTCCAGCATTCAAA
    GCTGGTAAAGCATTAAAAGATGCTGTAAAATAA
    60
    120
    180
    240
    273

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001457 [new locus tag: EGJ38_RS07275 ]
  • symbol: Hup
  • description: HU family DNA-binding protein
  • length: 90
  • theoretical pI: 10.3214
  • theoretical MW: 9625.94
  • GRAVY: -0.466667

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair integration host factor, beta subunit (TIGR00988; HMM-score: 85.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair integration host factor, alpha subunit (TIGR00987; HMM-score: 80.7)
    and 1 more
    Genetic information processing DNA metabolism Chromosome-associated proteins putative DNA-binding protein (TIGR01201; HMM-score: 22.4)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 129.2)
    and 7 more
    HU-HIG; HU domain fused to wHTH, Ig, or Glycine-rich motif (PF18291; HMM-score: 27.5)
    HU-CCDC81_bac_2; CCDC81-like prokaryotic HU domain 2 (PF18175; HMM-score: 23)
    HU-CCDC81_euk_2; CCDC81 eukaryotic HU domain 2 (PF18289; HMM-score: 17.8)
    no clan defined DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 17.1)
    IHF-likeDNA-bdg (CL0548) HU-CCDC81_euk_1; CCDC81 eukaryotic HU domain 1 (PF14908; HMM-score: 13.5)
    no clan defined DUF2780; Protein of unknown function VcgC/VcgE (DUF2780) (PF11075; HMM-score: 12.6)
    Glycos_trans_3N; Glycosyl transferase family, helical bundle domain (PF02885; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9891
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0108
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006571
    • TAT(Tat/SPI): 0.001468
    • LIPO(Sec/SPII): 0.001013
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423417 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]