From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS01145 [old locus tag: EGJ38_000229 ]
  • pan locus tag?: SAUPAN001178000
  • symbol: esaB
  • pan gene symbol?: esaB
  • synonym:
  • product: type VII secretion protein EsaB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS01145 [old locus tag: EGJ38_000229 ]
  • symbol: esaB
  • product: type VII secretion protein EsaB
  • replicon: chromosome
  • strand: +
  • coordinates: 269764..270006
  • length: 243
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (269764..270006) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATCAGCACGTAAAAGTAACATTTGATTTTACTAATTATAATTACGGCACATATGAC
    TTAGCAGTACCAGCATATTTACCGATAAAAAACTTAATAGCTTTAGTATTGGATAGTTTG
    GACATTTCAATATTTGATGTCAATACACAAATTAAAGTGATGACGAAAGGTCAATTACTT
    GTTGAAAATGATCGACTCATTGATTATCAAATCGCTGATGGAGATATTTTGAAGTTACTA
    TAG
    60
    120
    180
    240
    243

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS01145 [old locus tag: EGJ38_000229 ]
  • symbol: EsaB
  • description: type VII secretion protein EsaB
  • length: 80
  • theoretical pI: 4.32171
  • theoretical MW: 9120.5
  • GRAVY: 0.215

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    Ubiquitin (CL0072) YukD; WXG100 protein secretion system (Wss), protein YukD (PF08817; HMM-score: 46)
    and 4 more
    ubiquitin; Ubiquitin family (PF00240; HMM-score: 17.6)
    Rad60-SLD; Ubiquitin-2 like Rad60 SUMO-like (PF11976; HMM-score: 15.6)
    DMT (CL0184) Nuc_sug_transp; Nucleotide-sugar transporter (PF04142; HMM-score: 13)
    no clan defined DUF5488; Family of unknown function (DUF5488) (PF17590; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9597
    • Cytoplasmic Membrane Score: 0.0237
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0163
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001941
    • TAT(Tat/SPI): 0.000103
    • LIPO(Sec/SPII): 0.000302
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001071606 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]