Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS02455 [old locus tag: EGJ38_000492 ]
- pan locus tag?: SAUPAN002303000
- symbol: rpmG
- pan gene symbol?: rpmG
- synonym:
- product: 50S ribosomal protein L33
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS02455 [old locus tag: EGJ38_000492 ]
- symbol: rpmG
- product: 50S ribosomal protein L33
- replicon: chromosome
- strand: +
- coordinates: 523017..523160
- length: 144
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (523017..523160) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGAGAAAAATACCTTTAAATTGTGAAGCTTGTGGCAATAGAAATTATAATGTTCCTAAG
CAAGAAGGCTCGGCAACAAGATTAACCTTAAAGAAATATTGTCCAAAATGTAACGCGCAC
ACAATTCATAAAGAATCGAAATAA60
120
144
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS02455 [old locus tag: EGJ38_000492 ]
- symbol: RpmG
- description: 50S ribosomal protein L33
- length: 47
- theoretical pI: 10.0872
- theoretical MW: 5375.25
- GRAVY: -1.03617
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 51.7)
- TheSEED:
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 64.8)and 16 moreZn_ribbon_NOB1; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 16.5)Zn_ribbon_ZPR1; ZPR1 zinc-finger domain (PF03367; HMM-score: 15.6)Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 15.3)Zn_ribbon_Top1; Topoisomerase DNA binding C4 zinc finger (PF01396; HMM-score: 14.5)Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.2)Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.2)no clan defined DUF7340; Domain of unknown function (DUF7340) (PF24029; HMM-score: 14.2)Zn_Beta_Ribbon (CL0167) Zn_ribbon_Nudix; Nudix N-terminal (PF14803; HMM-score: 13.2)Zn_ribbon_NUD; NADH pyrophosphatase zinc ribbon domain (PF09297; HMM-score: 13)HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 12.8)Zn_ribbon_RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 12.2)no clan defined DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 12.1)VP_N-CPKC; Virion protein N terminal domain (PF11475; HMM-score: 12)Zn_Beta_Ribbon (CL0167) Zn_ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 12)Zn_ribbon_TFIIS; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 11.3)no clan defined Cys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 10.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4515
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.5482
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.269171
- TAT(Tat/SPI): 0.008157
- LIPO(Sec/SPII): 0.045224
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001788193 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]