Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS04985 [old locus tag: EGJ38_000998 ]
- pan locus tag?: SAUPAN003231000
- symbol: EGJ38_RS04985
- pan gene symbol?: —
- synonym:
- product: poly(glycerol-phosphate) alpha-glucosyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS04985 [old locus tag: EGJ38_000998 ]
- symbol: EGJ38_RS04985
- product: poly(glycerol-phosphate) alpha-glucosyltransferase
- replicon: chromosome
- strand: +
- coordinates: 1002511..1002648
- length: 138
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1002511..1002648) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCTGATAAAATACTAAAGCTTGTTAATAATGATGTTTTAGCAGAGGAGTTTGGTTCG
AAAGCGAGAGAAAACATTATAGAAAAATATTCAACGGAATCAATATTAGAAAAATGGTTA
AATCTTTTCAATAGCTAA60
120
138
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS04985 [old locus tag: EGJ38_000998 ]
- symbol: EGJ38_RS04985
- description: poly(glycerol-phosphate) alpha-glucosyltransferase
- length: 45
- theoretical pI: 4.56069
- theoretical MW: 5214.92
- GRAVY: -0.308889
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 16.9)sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03088; HMM-score: 16.1)Energy metabolism Biosynthesis and degradation of polysaccharides glycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 15.6)and 2 moresugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03087; HMM-score: 13.4)glycosyltransferase, GG-Bacteroidales peptide system (TIGR04157; EC 2.4.1.-; HMM-score: 12.6)
- TheSEED:
- PFAM: no clan defined TnpW; Transposon-encoded protein TnpW (PF14202; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7823
- Cytoplasmic Membrane Score: 0.0653
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.1521
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017002
- TAT(Tat/SPI): 0.000867
- LIPO(Sec/SPII): 0.003331
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001792054 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MADKILKLVNNDVLAEEFGSKARENIIEKYSTESILEKWLNLFNS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]