From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS06725 [old locus tag: EGJ38_001347 ]
  • pan locus tag?: SAUPAN003756000
  • symbol: EGJ38_RS06725
  • pan gene symbol?: dmpI
  • synonym:
  • product: 2-hydroxymuconate tautomerase

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS06725 [old locus tag: EGJ38_001347 ]
  • symbol: EGJ38_RS06725
  • product: 2-hydroxymuconate tautomerase
  • replicon: chromosome
  • strand: -
  • coordinates: 1361733..1361918
  • length: 186
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1361733..1361918) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCCAATCGTCAATGTAAAATTATTAGAAGGTCGTTCGGATGAACAATTAAAAAAATTA
    GTTAGCGAAGTAACTGACGCCGTAGAAAAAACAACGGGGGCAAATAGACAAGCAATTCAC
    GTTGTTATAGAAGAAATGAAACCAAACCATTATGGTGTGGCTGGCGTAAGAAAGTCAGAT
    CAATAA
    60
    120
    180
    186


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_RS06725 [old locus tag: EGJ38_001347 ]
  • symbol: EGJ38_RS06725
  • description: 2-hydroxymuconate tautomerase
  • length: 61
  • theoretical pI: 7.7003
  • theoretical MW: 6757.7
  • GRAVY: -0.47377

⊟Function[edit | edit source]

  • reaction:
    EC 5.3.2.6?  ExPASy
    2-hydroxymuconate tautomerase (2Z,4E)-2-hydroxyhexa-2,4-dienedioate = (3E)-2-oxohex-3-enedioate
  • TIGRFAM:
    Metabolism Energy metabolism Other 4-oxalocrotonate tautomerase family enzyme (TIGR00013; EC 5.3.2.-; HMM-score: 78.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    MIF (CL0082) Tautomerase; Tautomerase enzyme (PF01361; HMM-score: 91)
    and 1 more
    Tautomerase_2; Tautomerase enzyme (PF14552; HMM-score: 24)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9884
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0113
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00419
    • TAT(Tat/SPI): 0.001127
    • LIPO(Sec/SPII): 0.001226
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001123275 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MPIVNVKLLEGRSDEQLKKLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=EGJ38_RS06725&oldid=117973"