From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS07675 [old locus tag: EGJ38_001537 ]
  • pan locus tag?: SAUPAN004125000
  • symbol: EGJ38_RS07675
  • pan gene symbol?:
  • synonym:
  • product: MTH1187 family thiamine-binding protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS07675 [old locus tag: EGJ38_001537 ]
  • symbol: EGJ38_RS07675
  • product: MTH1187 family thiamine-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1574776..1575105
  • length: 330
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1574776..1575105) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCTATTGTTGATGTGGTTGTTATTCCAGTTGGAACGGAAGGTCCGAGTGTTAGTAAA
    TATATTGCAGATATTCAGAAAAAACTTCAAGAATATAAAGCAATGGGTAAAATTGATTTT
    CAATTAACACCAATGAATACTCTAATTGAAGGTGAATTAAGCGATGTATTAGAAGTTGTG
    CAAGTGATACATGAATTACCTTTTGATAAAGGTTTAAGTAGAGTTTGTACAAATATCCGT
    ATTGATGACCGACGAGACAAATCTAGAAAAATGAATGATAAACTAACATCAGTACAAAAA
    CATTTAGAAAATAGTGGTGAAAACCTATGA
    60
    120
    180
    240
    300
    330


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS07675 [old locus tag: EGJ38_001537 ]
  • symbol: EGJ38_RS07675
  • description: MTH1187 family thiamine-binding protein
  • length: 109
  • theoretical pI: 5.75172
  • theoretical MW: 12282.1
  • GRAVY: -0.301835

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 113.6)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 107.5)
    and 1 more
    no clan defined DUF2732; Protein of unknown function (DUF2732) (PF10809; HMM-score: 17.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9928
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0069
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003994
    • TAT(Tat/SPI): 0.000143
    • LIPO(Sec/SPII): 0.000378
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001018871 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAIVDVVVIPVGTEGPSVSKYIADIQKKLQEYKAMGKIDFQLTPMNTLIEGELSDVLEVVQVIHELPFDKGLSRVCTNIRIDDRRDKSRKMNDKLTSVQKHLENSGENL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]