Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS08500 [old locus tag: EGJ38_001702 ]
- pan locus tag?: SAUPAN004369000
- symbol: EGJ38_RS08500
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS08500 [old locus tag: EGJ38_001702 ]
- symbol: EGJ38_RS08500
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1744384..1744524
- length: 141
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1744384..1744524) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGATTATGCTTTTTTCACTACTTATATTAATTAAAACAACACATTTGATTACGTTTATC
TTTAAACAATTGCTATTTATATTTATTGTCCCTTTCATTTATCCATATAAAAAAGAAGCT
AGACAACGTATCGTTGGCTAA60
120
141
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS08500 [old locus tag: EGJ38_001702 ]
- symbol: EGJ38_RS08500
- description: hypothetical protein
- length: 46
- theoretical pI: 10.9001
- theoretical MW: 5558.93
- GRAVY: 1.09783
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for NCTC8325, USA300_FPR3757
- PFAM: Peroxisome (CL0484) Reticulon; Reticulon (PF02453; HMM-score: 15.4)and 1 moreno clan defined DUF2393; Protein of unknown function (DUF2393) (PF09624; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7494
- Cytoplasmic Membrane Score: 0.1367
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1139
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014584
- TAT(Tat/SPI): 0.001084
- LIPO(Sec/SPII): 0.022103
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001789981 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIMLFSLLILIKTTHLITFIFKQLLFIFIVPFIYPYKKEARQRIVG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]