From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS08950 [old locus tag: EGJ38_001792 ]
  • pan locus tag?: SAUPAN004532000
  • symbol: EGJ38_RS08950
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS08950 [old locus tag: EGJ38_001792 ]
  • symbol: EGJ38_RS08950
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1842116..1842292
  • length: 177
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1842116..1842292) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGATAGATTAAAATATTCACTTAAAGTTGGAATTTTAGCATTATTATTATTTTGTACT
    TTAAATTATTTAGTTCCAATGCAAAGAAATGCTTTTTCAATAATTATATATTCGGCAATT
    TTTGCTGTGTTACTTATGCTTTTAGTTTATATATTTTTAGGAATTTTAAAGAAATGA
    60
    120
    177


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_RS08950 [old locus tag: EGJ38_001792 ]
  • symbol: EGJ38_RS08950
  • description: hypothetical protein
  • length: 58
  • theoretical pI: 10.2004
  • theoretical MW: 6683.36
  • GRAVY: 1.35862

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 7.5)
  • TheSEED: data available for NCTC8325
  • PFAM:
    no clan defined Renin_r; Renin receptor-like transmembrane spanning segment (PF07850; HMM-score: 9.6)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 9.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9968
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0031
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.018991
    • TAT(Tat/SPI): 0.001166
    • LIPO(Sec/SPII): 0.331102
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000375475 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDRLKYSLKVGILALLLFCTLNYLVPMQRNAFSIIIYSAIFAVLLMLLVYIFLGILKK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=EGJ38_RS08950&oldid=118418"