From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS09900 [old locus tag: EGJ38_001983 ]
  • pan locus tag?: SAUPAN005266000
  • symbol: groES
  • pan gene symbol?: groES
  • synonym:
  • product: co-chaperone GroES

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS09900 [old locus tag: EGJ38_001983 ]
  • symbol: groES
  • product: co-chaperone GroES
  • replicon: chromosome
  • strand: -
  • coordinates: 1998219..1998503
  • length: 285
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1998219..1998503) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCTAAAACCAATTGGAAATCGTGTGATTATTGAGAAAAAAGAACAAGAACAAACAACT
    AAAAGTGGTATTGTTTTAACTGATAGTGCTAAAGAAAAATCAAACGAAGGCGTTATCGTT
    GCAGTAGGAACTGGACGTCTATTAAATGATGGTACAAGAGTGACTCCTGAAGTGAAAGAA
    GGGGACCGTGTCGTGTTCCAACAATATGCTGGTACAGAAGTTAAACGAGATAATGAAACA
    TATCTAGTATTAAATGAAGAAGATATTTTAGCAGTTATTGAATAA
    60
    120
    180
    240
    285


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_RS09900 [old locus tag: EGJ38_001983 ]
  • symbol: GroES
  • description: co-chaperone GroES
  • length: 94
  • theoretical pI: 4.57199
  • theoretical MW: 10415.7
  • GRAVY: -0.439362

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9985
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0012
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006421
    • TAT(Tat/SPI): 0.000738
    • LIPO(Sec/SPII): 0.001003
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000917289 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKEGDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]