Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS11415 [old locus tag: EGJ38_002287 ]
- pan locus tag?: SAUPAN005799000
- symbol: EGJ38_RS11415
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS11415 [old locus tag: EGJ38_002287 ]
- symbol: EGJ38_RS11415
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2283776..2283967
- length: 192
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2283776..2283967) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATGGGTTACATTATATTGTTTTTTCTAGCTGGTCCAGTAATTTTAGGCGTTGGAAAT
TTGGTGATTGGTCCTATATTTAACAAACAGACACCATTTCGCGTGCAAGTAAGATCTTTT
GTTGTTGGTTCAATGATTTACTTAATACTCGCAACAATTGGCTATTTTTTACTATTACAA
GGTAAACTTTAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS11415 [old locus tag: EGJ38_002287 ]
- symbol: EGJ38_RS11415
- description: hypothetical protein
- length: 63
- theoretical pI: 10.5722
- theoretical MW: 6962.54
- GRAVY: 1.2746
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: no clan defined YrhK; YrhK-like protein (PF14145; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9986
- Cell wall & surface Score: 0
- Extracellular Score: 0.0013
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010588
- TAT(Tat/SPI): 0.000193
- LIPO(Sec/SPII): 0.096083
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000971980 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQGKL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]