Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS12980 [old locus tag: EGJ38_002600 ]
- pan locus tag?: SAUPAN006321000
- symbol: nrdG
- pan gene symbol?: nrdG
- synonym:
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS12980 [old locus tag: EGJ38_002600 ]
- symbol: nrdG
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
- replicon: chromosome
- strand: -
- coordinates: 2605457..2605993
- length: 537
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2605457..2605993) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGACACTTTTAGACATTAAACAAGGACAAGGTTATATTGCTAAAATAGAATCAAATAGC
TTTGTTGACGGTGAAGGAGTAAGATGCAGTGTTTATGTATCAGGATGTCCATTTAATTGT
GTTGGATGTTATAACAAAGCCTCACAAAAGTTCAGATATGGCGAGAAATACACTGATGAA
ATATTAGCAGAAATATTAGATGATTGCGATCATGATTATATATCTGGGCTAAGTCTATTA
GGTGGCGAACCATTTTGTAATTTGGATATTACATTAAATCTTGTCAAAGCATTTCGAGCA
CGTTTTGGAAATACAAAGACAATTTGGGTATGGACTGGATTTTTATATGAATATTTAGCA
AATGATTGTACAGAACGTCGAGAGTTATTATCATACATTGACGTTTTAGTAGATGGTCTA
TTTATACAACACTTATTCAAACCTGATTTACCATATAAAGGTTCTTTAAATCAACGCATT
ATAGATGTACAACAATCACTCTCGCATGCGCGTATGATTGAATATATAGTTAGTTGA60
120
180
240
300
360
420
480
537
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS12980 [old locus tag: EGJ38_002600 ]
- symbol: NrdG
- description: anaerobic ribonucleoside-triphosphate reductase activating protein
- length: 178
- theoretical pI: 4.81826
- theoretical MW: 20281
- GRAVY: -0.0674157
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 159.3)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 159.3)and 18 morePurines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 55.6)Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 43.2)Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 43.2)glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 41.9)Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.2)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.2)Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 34.8)Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 28.8)Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 25.9)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 19.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 15.9)pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 15.2)putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 14.7)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin probable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 13.2)Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 12.4)putative geopeptide radical SAM maturase (TIGR04280; HMM-score: 11.7)B12-binding domain/radical SAM domain protein, rhizo-twelve system (TIGR04295; HMM-score: 10.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: 4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 165.9)and 1 moreTIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 36)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8689
- Cytoplasmic Membrane Score: 0.0201
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.1106
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.318189
- TAT(Tat/SPI): 0.001811
- LIPO(Sec/SPII): 0.016352
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000173331 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDEILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLANDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: NrdR see EGJ38_002600
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]