(Redirected from JSNZ 000857)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
- pan locus tag?: SAUPAN002982000
- symbol: EGJ38_000857
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000857
- product: HK97-gp10 family putative phage morphogenesis protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
- symbol: EGJ38_000857
- product: HK97-gp10 family putative phage morphogenesis protein
- replicon: chromosome
- strand: +
- coordinates: 860090..860437
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422831 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATATAGATGGATTAGACGCACTGTTAAACCAATTTCACGATATGAAAACCAACATT
GATGATGATGTTGATGATATTTTACAGGAAAACGCCAAAGAATATGTAGTACGAGCTAAA
TTGAAAGCTAGAGAAGTAATGAATAAGGGTTATTGGACTGGTAATTTATCACGCAATATC
AGATATAAAAAAACTGGCGATTTGCAATACACTATCACATCGCATGCAGCTTATAGTGGT
TTCTTAGAGTTTGGTACTCGATACATGGAGGCAGAACCTTTTATGTGGCCAGTATATGAG
GTAATAAGAAAATCAACTGTAGAAGAATTGAAAGCGTTGTTTGAATAG60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
- symbol: EGJ38_000857
- description: HK97-gp10 family putative phage morphogenesis protein
- length: 115
- theoretical pI: 4.9411
- theoretical MW: 13465.2
- GRAVY: -0.541739
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage protein, HK97 gp10 family (TIGR01725; HMM-score: 90.1)and 1 moreProtein fate Degradation of proteins, peptides, and glycopeptides ubiquitin-like protein Pup (TIGR03687; HMM-score: 15.1)
- TheSEED:
- PFAM: Phage_tail (CL0348) HK97-gp10_like; Bacteriophage HK97-gp10, putative tail-component (PF04883; HMM-score: 51.9)and 2 moreHistone (CL0012) TFIID_20kDa; Transcription initiation factor TFIID subunit A (PF03847; HMM-score: 13.9)no clan defined Pup; Pup-like protein (PF05639; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2876
- Cytoplasmic Membrane Score: 0.0513
- Cell wall & surface Score: 0.0169
- Extracellular Score: 0.6443
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006787
- TAT(Tat/SPI): 0.000509
- LIPO(Sec/SPII): 0.000575
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422831 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNIDGLDALLNQFHDMKTNIDDDVDDILQENAKEYVVRAKLKAREVMNKGYWTGNLSRNIRYKKTGDLQYTITSHAAYSGFLEFGTRYMEAEPFMWPVYEVIRKSTVEELKALFE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000850 > EGJ38_000851 > EGJ38_000852 > EGJ38_000853 > EGJ38_000854 > EGJ38_000855 > EGJ38_000856 > EGJ38_000857 > EGJ38_000858 > EGJ38_000859
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)