(Redirected from JSNZ 001281)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
- pan locus tag?: SAUPAN003627000
- symbol: EGJ38_001281
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001281
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
- symbol: EGJ38_001281
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1299258..1299455
- length: 198
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423246 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATTGCTATGATGAAATATTCAATACAATCAAAAAGTTGATAGAAAACAAAGAGATA
TCGAGTTATCAAATTAATAAAGATACTGGGATAAGTTACGGTAATATTAATGCTATGCGC
CGTGGAGAAAGAAGAATAGAAAATTTAAGCTTAAAGAATTCAAAAATCTTATATGAATAT
GCGAAAAAGGTATTATAA60
120
180
198
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001281 [new locus tag: EGJ38_RS06400 ]
- symbol: EGJ38_001281
- description: hypothetical protein
- length: 65
- theoretical pI: 9.72877
- theoretical MW: 7676.8
- GRAVY: -0.698462
⊟Function[edit | edit source]
- TIGRFAM: EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 16.3)
- TheSEED: data available for COL, NCTC8325
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.3)HTH_60; Helix-turn-helix domain (PF20317; HMM-score: 20.8)and 1 moreHTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7583
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.2416
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019503
- TAT(Tat/SPI): 0.001036
- LIPO(Sec/SPII): 0.003167
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423246 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNCYDEIFNTIKKLIENKEISSYQINKDTGISYGNINAMRRGERRIENLSLKNSKILYEYAKKVL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]