From AureoWiki
(Redirected from JSNZ 001290)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001290 [new locus tag: EGJ38_RS06445 ]
  • pan locus tag?: SAUPAN003641000
  • symbol: EGJ38_001290
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001290
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001290 [new locus tag: EGJ38_RS06445 ]
  • symbol: EGJ38_001290
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1304859..1305110
  • length: 252
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423255 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGATTATTATGAGGAAGTTAAAAGAAGATAATCAAGTTATAGTATATGAATATATTCCA
    CAAGATAAAATAGAAAAAGGGAAAGGCGAAATAACAGTAAATAAATTAGATTCAAAGGTA
    ATTGACTATAAATTATCAAAAGTTGAAAATGAAAAATGTATTTTAGTTTATAGAGATAAA
    TCATTTCATGCAATATTAAATTTTATTGATGAAAATAAATTTCCGAATGAATATATATAT
    GCATGGTATTAA
    60
    120
    180
    240
    252

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001290 [new locus tag: EGJ38_RS06445 ]
  • symbol: EGJ38_001290
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 7.34022
  • theoretical MW: 10023.6
  • GRAVY: -0.495181

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    FMN-binding (CL0336) PilZ-like; PilZ domain-like (PF22006; HMM-score: 14.5)
    no clan defined DUF2023; Protein of unknown function (DUF2023) (PF09633; HMM-score: 13.4)
    TRASH (CL0175) Ribosomal_L24e; Ribosomal protein L24e (PF01246; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7417
    • Cytoplasmic Membrane Score: 0.0284
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.2292
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005186
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.000813
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423255 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIIMRKLKEDNQVIVYEYIPQDKIEKGKGEITVNKLDSKVIDYKLSKVENEKCILVYRDKSFHAILNFIDENKFPNEYIYAWY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]