From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001294
  • pan locus tag?: SAUPAN003656000
  • symbol: JSNZ_001294
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001294
  • symbol: JSNZ_001294
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1305999..1306211
  • length: 213
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGAGAAAAATGAAAGTAATATTACTGACGTAACTCAGAACGAAGAGCAACTAGACAAC
    AGTGATGAACAATCACAACAGAATGAGAAAACATTTTCTCAAGAAGAAGTATCACAATTG
    ATTAAAGAGCGTATAGCTAGAGAACGCAAAAAATCAGATGAACATATTAAAGATGCAGTT
    CAAGAAGCTGAGAAGTTAGCTAAAATGAAGTAG
    60
    120
    180
    213

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001294
  • symbol: JSNZ_001294
  • description: hypothetical protein
  • length: 70
  • theoretical pI: 4.47678
  • theoretical MW: 8235.92
  • GRAVY: -1.59143

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Other phosphonate metabolism protein PhnM (TIGR02318; HMM-score: 10.8)
  • TheSEED:
  • PFAM:
    no clan defined DUF4355; Capsid assembly scaffolding protein Gp46 (PF14265; HMM-score: 24.3)
    and 3 more
    SOGA1-2-like_CC; SOGA 1/2-like, coiled-coil (PF14818; HMM-score: 11.9)
    Spore_II_R; Stage II sporulation protein R (spore_II_R) (PF09551; HMM-score: 9.1)
    S5 (CL0329) EFL1; Elongation factor-like GTPase 1-like domain (PF25118; HMM-score: 8.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9941
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0018
    • Extracellular Score: 0.0039
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004716
    • TAT(Tat/SPI): 0.002017
    • LIPO(Sec/SPII): 0.001642
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MEKNESNITDVTQNEEQLDNSDEQSQQNEKTFSQEEVSQLIKERIARERKKSDEHIKDAVQEAEKLAKMK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]