Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001693
- pan locus tag?: SAUPAN004360000
- symbol: JSNZ_001693
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001693
- symbol: JSNZ_001693
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1735856..1735969
- length: 114
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGAATGATATTGATTTGATTCATTACATGTTACTGATGAACATACCTGCATATGTGTTT
CTAGCTTGTTTGTTACATATTGCATTTAGACTTGGACAAAAATTTATGTCCTAG60
114
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001693
- symbol: JSNZ_001693
- description: hypothetical protein
- length: 37
- theoretical pI: 7.51671
- theoretical MW: 4357.33
- GRAVY: 0.945946
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined EIID-AGA; PTS system mannose/fructose/sorbose family IID component (PF03613; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9989
- Cell wall & surface Score: 0
- Extracellular Score: 0.0009
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029773
- TAT(Tat/SPI): 0.003814
- LIPO(Sec/SPII): 0.299917
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MNDIDLIHYMLLMNIPAYVFLACLLHIAFRLGQKFMS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]