Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001717
- pan locus tag?: SAUPAN004391000
- symbol: JSNZ_001717
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001717
- symbol: JSNZ_001717
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1759790..1759882
- length: 93
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61TTGAAAATAATCTTACTGCTGTTTTTAATATTTGGATGCATTGTTGTGGTTACTTTAAAA
AGTGAGCATCAATTAACGCTTTTTTCGATTTAA60
93
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001717
- symbol: JSNZ_001717
- description: hypothetical protein
- length: 30
- theoretical pI: 8.54806
- theoretical MW: 3433.32
- GRAVY: 1.77
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0491
- Cytoplasmic Membrane Score: 0.7744
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1763
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 12 aa
- SP(Sec/SPI): 0.151497
- TAT(Tat/SPI): 0.003054
- LIPO(Sec/SPII): 0.553333
- Cleavage Site: CS pos: 12-13. IFG-CI. Pr: 0.5042
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKIILLLFLIFGCIVVVTLKSEHQLTLFSI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]