From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001969
  • pan locus tag?: SAUPAN005000000
  • symbol: JSNZ_001969
  • pan gene symbol?: pmtR
  • synonym:
  • product: GntR family transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001969
  • symbol: JSNZ_001969
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1981911..1982291
  • length: 381
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAACAGATTAAGCAACAA
    GTAAAACAAAATATTTTAAAGGGATATGTTGCTCCTGGAGAGCATTTGCCGTCAATGAGA
    GAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGTGCTTATGAAGATTTA
    GAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTTGTTAAGGAGCAAGAT
    AGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTGGTTAAAGAATTGGTT
    AATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTTCAAGATATTTTAACGTTCATT
    TATGAGGAGGAATCATCATGA
    60
    120
    180
    240
    300
    360
    381

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001969
  • symbol: JSNZ_001969
  • description: GntR family transcriptional regulator
  • length: 126
  • theoretical pI: 4.59104
  • theoretical MW: 14558.6
  • GRAVY: -0.415873

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 58.1)
    Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 58.1)
    and 13 more
    Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 42.8)
    Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 42.8)
    Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 42.6)
    Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 34.7)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 31.6)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 24.5)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 21.3)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 21.3)
    Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 21.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13.6)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13.6)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 13.6)
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 13.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 61.5)
    and 13 more
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.9)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 18.1)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.8)
    DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 15.7)
    no clan defined Uso1_p115_C; Uso1 / p115 like vesicle tethering protein, C terminal region (PF04871; HMM-score: 14.4)
    SabA_adhesion; SabA N-terminal extracellular adhesion domain (PF18304; HMM-score: 14.1)
    HTH (CL0123) HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 13.7)
    HTH_11; HTH domain (PF08279; HMM-score: 13.5)
    no clan defined STX6_10_61_N; Syntaxin 6/10/61, N-terminal (PF09177; HMM-score: 13.4)
    HTH (CL0123) RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.2)
    MarR; MarR family (PF01047; HMM-score: 13)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13)
    LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: Phenol-soluble modulins (PSMs) [1]
  • genes regulated by PmtR*, TF important in Hypothetical ABC transportersee RegPrecise for N315
    repression
    pmtD < pmtC < pmtB < pmtA < pmtR*

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8727
    • Cytoplasmic Membrane Score: 0.1126
    • Cell wall & surface Score: 0.0127
    • Extracellular Score: 0.0021
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003131
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.000305
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MKIILKNNSDFPIYEQIKQQVKQNILKGYVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: PmtR* (repression) regulon
    PmtR*(TF)important in Hypothetical ABC transporter;  regulation predicted or transferred from N315 and NCTC 8325  [3]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Hwang-Soo Joo, Michael Otto
    Toxin-mediated gene regulatory mechanism in Staphylococcus aureus.
    Microb Cell: 2016, 4(1);29-31
    [PubMed:28357385] [WorldCat.org] [DOI] (P e)
  2. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  3. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=JSNZ_001969&oldid=107610"