From AureoWiki
(Redirected from JSNZ 002032)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002032 [new locus tag: EGJ38_RS10145 ]
  • pan locus tag?: SAUPAN005342000
  • symbol: acpS
  • pan gene symbol?: acpS
  • synonym:
  • alternate name: JSNZ_002032
  • product: holo-ACP synthase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002032 [new locus tag: EGJ38_RS10145 ]
  • symbol: acpS
  • product: holo-ACP synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 2046347..2046706
  • length: 360
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423933 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATACATGGAATTGGTGTAGATTTAATCGAAATCGATCGAATACAATTGTTATATAGT
    AAGCAACCAAAATTGGTTGAGCGGATTTTAACTAAAAATGAACAGCACAAATTCAACAAT
    TTCACACATGAGCAACGTAAAATTGAATTTTTAGCTGGCAGGTTTGCTACAAAAGAAGCG
    TTCAGTAAAGCATTAGGCACAGGCTTAGGAAAACATGTAGCTTTTAACGATATAGACTGT
    TACAACGACGAACTTGGCAAACCAAAGATTGATTACGAAGGGTTTATCGTACATGTTAGT
    ATCTCACACACTGAGCATTATGCGATGAGCCAAGTTGTTTTAGAAAAGTCAGCATTTTAA
    60
    120
    180
    240
    300
    360

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002032 [new locus tag: EGJ38_RS10145 ]
  • symbol: AcpS
  • description: holo-ACP synthase
  • length: 119
  • theoretical pI: 7.2338
  • theoretical MW: 13647.5
  • GRAVY: -0.302521

Function[edit | edit source]

  • reaction:
    EC 2.7.8.7?  ExPASy
    Holo-[acyl-carrier-protein] synthase CoA-(4'-phosphopantetheine) + apo-[acyl-carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier-protein]
  • TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis holo-[acyl-carrier-protein] synthase (TIGR00516; EC 2.7.8.7; HMM-score: 114.8)
    Genetic information processing Protein fate Protein modification and repair phosphopantetheine--protein transferase domain (TIGR00556; HMM-score: 94.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    4PPT (CL0670) ACPS; 4'-phosphopantetheinyl transferase superfamily (PF01648; HMM-score: 67.4)
    and 2 more
    4PPT_N; 4'-phosphopantetheinyl transferase N-terminal domain (PF17837; HMM-score: 26.3)
    AASDHPPT_N; 4'-phosphopantetheinyl transferase, N-terminal (PF22624; HMM-score: 15.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9932
    • Cytoplasmic Membrane Score: 0.0031
    • Cell wall & surface Score: 0.0011
    • Extracellular Score: 0.0025
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003604
    • TAT(Tat/SPI): 0.001248
    • LIPO(Sec/SPII): 0.001269
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423933 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIHGIGVDLIEIDRIQLLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]