(Redirected from JSNZ 002373)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002373 [new locus tag: EGJ38_RS11845 ]
- pan locus tag?: SAUPAN005936000
- symbol: EGJ38_002373
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002373
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002373 [new locus tag: EGJ38_RS11845 ]
- symbol: EGJ38_002373
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2374488..2374670
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424257 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGTAGAACGTTATATCAAAGTTTTAATATTATATATTTTCACAACACTACTATCTTCT
ATTTCAGTAACGTCAAAATGTGTACCTAATAAAGTTATAAGGTTTATTTTACGTACTGCA
ATTGGTTACAGTGTATTTGCATATGGTTTACATTACTTTTCAAATTTAAAAAAGAATAAG
TAA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002373 [new locus tag: EGJ38_RS11845 ]
- symbol: EGJ38_002373
- description: hypothetical protein
- length: 60
- theoretical pI: 10.5747
- theoretical MW: 6962.35
- GRAVY: 0.531667
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9355
- Cell wall & surface Score: 0
- Extracellular Score: 0.0641
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 26 aa
- SP(Sec/SPI): 0.330076
- TAT(Tat/SPI): 0.002463
- LIPO(Sec/SPII): 0.473076
- Cleavage Site: CS pos: 26-27. TSK-CV. Pr: 0.3587
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424257 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSVFAYGLHYFSNLKKNK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]