Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002498
- pan locus tag?: SAUPAN006165000
- symbol: JSNZ_002498
- pan gene symbol?: —
- synonym:
- product: GNAT family N-acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002498
- symbol: JSNZ_002498
- product: GNAT family N-acetyltransferase
- replicon: chromosome
- strand: +
- coordinates: 2506236..2506520
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGATGATGAAAAT
AATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAACATTGATCAT
ACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTAGTTAAAGCAGTT
GTTGAACACGCTCGAGAAAATAATTTGAAAATTATTGCCTCATGTTCATTTGCCAAAAAT
ATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002498
- symbol: JSNZ_002498
- description: GNAT family N-acetyltransferase
- length: 94
- theoretical pI: 4.41697
- theoretical MW: 10510.6
- GRAVY: -0.557447
⊟Function[edit | edit source]
- reaction: EC 2.3.1.-? ExPASy
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 20.9)and 2 moremethanogenesis imperfect marker protein 11 (TIGR03280; HMM-score: 12.9)poly-gamma-glutamate system protein (TIGR04332; HMM-score: 12.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Acetyltrans (CL0257) Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 97.3)and 3 moreAcetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 33.9)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 25)Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 24.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9593
- Cytoplasmic Membrane Score: 0.0303
- Cell wall & surface Score: 0.0034
- Extracellular Score: 0.0069
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004181
- TAT(Tat/SPI): 0.000213
- LIPO(Sec/SPII): 0.00041
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENNLKIIASCSFAKNMLEKEDSYQDVYLG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]