From AureoWiki
(Redirected from JSNZ 002691)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002691 [new locus tag: EGJ38_RS13435 ]
  • pan locus tag?: SAUPAN006468000
  • symbol: vraH
  • pan gene symbol?: vraH
  • synonym:
  • alternate name: JSNZ_002691
  • product: peptide resistance ABC transporter activity modulator VraH

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002691 [new locus tag: EGJ38_RS13435 ]
  • symbol: vraH
  • product: peptide resistance ABC transporter activity modulator VraH
  • replicon: chromosome
  • strand: +
  • coordinates: 2710146..2710337
  • length: 192
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424568 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAATTTAGAGAATTAGTAAAACAATCATATGAGGATTTGAAAAATTTGACTGTAACT
    TGGTATAACGTCATTGCTTTAACAATACTTGTTATTGTATTAAGCTCATTCACAACACCA
    ATGATAGGCATTCCAGCTGGTTTATTAGGTGGCTCTTATTATTTAAAACGTCGTGAAGAA
    AAAGGCAAGTAA
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002691 [new locus tag: EGJ38_RS13435 ]
  • symbol: VraH
  • description: peptide resistance ABC transporter activity modulator VraH
  • length: 63
  • theoretical pI: 10.1048
  • theoretical MW: 7194.5
  • GRAVY: 0.12381

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 13.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0004
    • Cytoplasmic Membrane Score: 0.9623
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0371
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.113277
    • TAT(Tat/SPI): 0.001752
    • LIPO(Sec/SPII): 0.015458
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424568 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKFRELVKQSYEDLKNLTVTWYNVIALTILVIVLSSFTTPMIGIPAGLLGGSYYLKRREEKGK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]