Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS091 [new locus tag: SA_RS14260 ]
- pan locus tag?: SAUPAN006468000
- symbol: SAS091
- pan gene symbol?: vraH
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS091 [new locus tag: SA_RS14260 ]
- symbol: SAS091
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2805913..2806104
- length: 192
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1125424 NCBI
- RefSeq: NP_375821 NCBI
- BioCyc: see SA_RS14260
- MicrobesOnline: 104847 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAATTTAGAGAATTAGTAAAACAATCATACGAGGATTTGAAAAATTTGACTGTAACT
TGGTATAACGTGATTGCTTTAGCAATGATTGTTATTGTCTTAAGCGTAGTTACAACACCA
ATTATAGGTATTCCAGCTGGTTTATTAGGTGGCGCTTATTATTTAAAACGTCGTGAAGAA
AAAGGTAAATAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS091 [new locus tag: SA_RS14260 ]
- symbol: SAS091
- description: hypothetical protein
- length: 63
- theoretical pI: 10.1048
- theoretical MW: 7112.48
- GRAVY: 0.31746
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 14.6)
- TheSEED :
- Uncharacterized protein SAV2703
- PFAM: no clan defined DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 15.2)DUF6632; Family of unknown function (DUF6632) (PF20337; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0009
- Cytoplasmic Membrane Score: 0.936
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0627
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.054503
- TAT(Tat/SPI): 0.000942
- LIPO(Sec/SPII): 0.004756
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFRELVKQSYEDLKNLTVTWYNVIALAMIVIVLSVVTTPIIGIPAGLLGGAYYLKRREEKGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]