Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- pan locus tag?: SAUPAN001103000
- symbol: NWMN_0174
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- symbol: NWMN_0174
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 225884..226240
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330029 NCBI
- RefSeq: YP_001331209 NCBI
- BioCyc:
- MicrobesOnline: 3705705 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACCGTAGATATTGGACGGATTTATGACAATAAAGATAATACCGACGCTATTCGTATC
CTAGTCGATAGAGTCTGGCCGAGAGGTATTTCGAAAAGAACTGCTAACCTAGATTATTGG
TTAAAAGACATTGCCCCTTCTACTGAGTTGCGACAATGGTTCCAACATGATCCTAAACTT
TTTGGAGCTTTTAAAGAAAAATATGAAAAAGAATTACGTGATCAGGATGCGCAAAAAGAT
GCTTTTGAAAAATTAAAGGATATTGTAAATCAGCATAATCATGTTCTATTGTTATATGCA
GCAAAAGATACTAAACATAACCAAGCTGTAGTACTACAGCAGTTGCTCAATACTTAG60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- symbol: NWMN_0174
- description: hypothetical protein
- length: 118
- theoretical pI: 8.87228
- theoretical MW: 13934.7
- GRAVY: -0.734746
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined DUF488; Protein of unknown function, DUF488 (PF04343; HMM-score: 110.5)and 2 moreHLH; Helix-loop-helix DNA-binding domain (PF00010; HMM-score: 12.9)Chemosens_recp (CL0176) 7tm_6; 7tm Odorant receptor (PF02949; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002823
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.000548
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKLFGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- NWMN_0174 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]