Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0283 [new locus tag: NWMN_RS01600 ]
- pan locus tag?: SAUPAN000175000
- symbol: NWMN_0283
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0283 [new locus tag: NWMN_RS01600 ]
- symbol: NWMN_0283
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 334864..335148
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5330122 NCBI
- RefSeq: YP_001331317 NCBI
- BioCyc:
- MicrobesOnline: 3705814 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAACTATGAAACAGGGGTCCAACTAGGTGTAATGGACGCTAGGTTGAAGAAGATGAGA
AAACAACGTGATGAGTACAAGAAGCAACGTGATGAGCTTATTGGGGATATAGGTAAGTTA
AGAGAACGCAACAAAGAGCTGGAGAAGAAAGCAAGTGCATGGGATAGGTATTGCAAGAGC
GTTGAAAAAGATTTAATAAACGAATTTGGCAAAGATGGTGAAAGAGTTAAATTTGGAATG
GAATTAAACAATAAAACTTTTATGGAGGAAGACACTAATGAATAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0283 [new locus tag: NWMN_RS01600 ]
- symbol: NWMN_0283
- description: hypothetical protein
- length: 94
- theoretical pI: 8.4404
- theoretical MW: 11224.7
- GRAVY: -1.32128
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage protein
- PFAM: no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 18.8)OVT1; Major antigen, helical domain (PF24423; HMM-score: 18.5)Cep57_CLD_2; Centrosome localisation domain of PPC89 (PF14197; HMM-score: 17.5)Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 15.9)and 6 moreTPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 14.7)no clan defined ATR1_N; ATR1 N-terminal domain (PF22223; HMM-score: 14.2)PP28; Casein kinase substrate phosphoprotein PP28 (PF10252; HMM-score: 13.3)DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 12.8)TMF_DNA_bd; TATA element modulatory factor 1 DNA binding (PF12329; HMM-score: 12.8)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9614
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0377
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007595
- TAT(Tat/SPI): 0.000686
- LIPO(Sec/SPII): 0.002287
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNYETGVQLGVMDARLKKMRKQRDEYKKQRDELIGDIGKLRERNKELEKKASAWDRYCKSVEKDLINEFGKDGERVKFGMELNNKTFMEEDTNE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]