Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0312 [new locus tag: NWMN_RS01775 ]
- pan locus tag?: SAUPAN000606000
- symbol: NWMN_0312
- pan gene symbol?: —
- synonym:
- product: phage holin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0312 [new locus tag: NWMN_RS01775 ]
- symbol: NWMN_0312
- product: phage holin
- replicon: chromosome
- strand: +
- coordinates: 361422..361724
- length: 303
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5330151 NCBI
- RefSeq: YP_001331346 NCBI
- BioCyc:
- MicrobesOnline: 3705843 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGATGCAAAAGTAATAACAAGATACATCGTATTGATCTTAGCATTAGTAAATCAATTC
TTAGCGAATAAAGGTATAAGTCCGATACCAGTAGATGAAGAAAGTGTTTCATCGATTATC
TTAACAGTTGTTGCTTTATATACTACATATAAAGATAATCCAACATCTCAAGAAGGGAAA
TGGGCGAATCAAAAATTAAAGAAATATAAAGCTGAAAGTAAATATAGAAAAGCAACAGGA
CAAGCACCTATTAAAGAAGTAATGACACCTACGAATATGAACGACACAAATGATTTAGGG
TAG60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0312 [new locus tag: NWMN_RS01775 ]
- symbol: NWMN_0312
- description: phage holin
- length: 100
- theoretical pI: 9.66058
- theoretical MW: 11133.8
- GRAVY: -0.306
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions holin, SPP1 family (TIGR01592; HMM-score: 101.5)
- TheSEED :
- Phage holin
- PFAM: no clan defined Holin_SPP1; SPP1 phage holin (PF04688; HMM-score: 50)and 1 moreTurandot; Stress-inducible humoral factor Turandot (PF07240; HMM-score: 14.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0026
- Cytoplasmic Membrane Score: 0.9188
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0777
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.5
- Signal peptide possibility: 0
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.387011
- TAT(Tat/SPI): 0.003022
- LIPO(Sec/SPII): 0.037432
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGKWANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]