From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0378 [new locus tag: NWMN_RS02140 ]
  • pan locus tag?: SAUPAN001994000
  • symbol: NWMN_0378
  • pan gene symbol?: xpt
  • synonym:
  • product: xanthine phosphoribosyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0378 [new locus tag: NWMN_RS02140 ]
  • symbol: NWMN_0378
  • product: xanthine phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 426067..426645
  • length: 579
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    GTGGAGTTACTAGGACAAAAAGTAAAGGAAGACGGCGTTGTCATTGATGAGAAGATTTTA
    AAAGTCGATGGATTTTTAAATCATCAAATTGATGCAAAGTTAATGAATGAAGTTGGTCGC
    ACTTTTTACGAGCAATTTAAAGATAAAGGGATTACTAAAATCTTAACCATTGAAGCTTCC
    GGTATCGCACCTGCAATCATGGCTGCACTGCATTTTGATGTGCCATGTTTATTTGCGAAA
    AAAGCAAAACCTAGCACTTTGACGGATGGTTATTATGAAACATCTATTCATTCATTTACT
    AAAAATAAAACAAGTACGGTCATTGTTTCAAAAGAGTTTTTATCAGAAGAAGATACTGTA
    CTTATCATCGATGACTTTTTAGCAAATGGTGATGCTTCATTAGGATTATACGATATCGCA
    CAGCAAGCGAATGCTAAGACAGCTGGTATTGGTATTGTTGTTGAAAAGAGTTTCCAAAAT
    GGGCATCAACGTTTAGAAGAAGCAGGTTTAACAGTTTCTTCTCTCTGCAAGGTTGCTTCA
    CTAGAAGGAAACAAAGTGACATTGGTGGGAGAAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    579

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0378 [new locus tag: NWMN_RS02140 ]
  • symbol: NWMN_0378
  • description: xanthine phosphoribosyltransferase
  • length: 192
  • theoretical pI: 4.79798
  • theoretical MW: 20883.7
  • GRAVY: -0.0328125

Function[edit | edit source]

  • reaction:
    EC 2.4.2.22?  ExPASy
    Xanthine phosphoribosyltransferase XMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + xanthine
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides xanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 331)
    and 5 more
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis pur operon repressor PurR (TIGR01743; HMM-score: 55.6)
    Signal transduction Regulatory functions DNA interactions pur operon repressor PurR (TIGR01743; HMM-score: 55.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 40)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 19.8)
    4-hydroxyphenylacetate 3-monooxygenase, oxygenase component (TIGR02309; EC 1.14.14.9; HMM-score: 11.2)
  • TheSEED:  
    Nucleosides and Nucleotides Purines Purine conversions  Xanthine phosphoribosyltransferase (EC 2.4.2.22)
    and 1 more
    Xanthine Metabolism in Bacteria  Xanthine phosphoribosyltransferase (EC 2.4.2.22)
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 27.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003881
    • TAT(Tat/SPI): 0.000415
    • LIPO(Sec/SPII): 0.000337
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAALHFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIAQQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLEGNKVTLVGEE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: G-box (transcription termination) regulon
    G-box(RNA)important in Purine metabolism; regulatory site identified based on RegPrecise data for N315 RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]