From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0451 [new locus tag: NWMN_RS02570 ]
  • pan locus tag?: SAUPAN002223000
  • symbol: NWMN_0451
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0451 [new locus tag: NWMN_RS02570 ]
  • symbol: NWMN_0451
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 513570..514295
  • length: 726
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTAAAAGAGAATGAACGATTTGATCAACTAATCAAAGAAGATTTTAGTATTATTCAA
    AATGATGATGTTTTTTCATTTTCAACGGATGCTTTGTTGTTAGGGCATTTTACAAAACCT
    AGAACAAAAGATATTGTGTTGGACTTATGTTCAGGCAATGGGGTGATACCCTTGTTATTG
    TTTGCGAAACATCCACGACATATAGAAGGTGTTGAGATTCAAAAAACACTTGTCGATATG
    GCGCGACGCACATTTCAATTCAATGATGTTGATGAATATTTAACAATGCATCACATGGAT
    TTGAAAAACGTTACTAAAGTATTTAAACCTTCACAATATACTTTAGTAACGTGTAATCCG
    CCTTATTTTAAAGAGAATCAGCAACACCAACATCAAAAAGAAGCACATAAGATAGCGAGA
    CATGAGATTATGTGTACACTTGAAGATTGCATGATTGCAGCCCGTCATTTATTAAAAGAA
    GGTGGCAGGCTAAACATGGTACATCGTGCAGAGAGACTAATGGATGTCTTGTTTGAAATG
    AGAAAAGTGAATATTGAACCTAAGAAAGTCGTTTTTATATATAGTAAAGTAGGGAAATCA
    GCACAAACGATAGTAGTAGAAGGTCGAAAAGGTGGAAATCAAGGTTTAGAAATCATGCCC
    CCATTTTATATTTATAATGAAGATGGTAATTATAGCGAAGAAATGAAGGAAGTATATTAT
    GGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    726

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0451 [new locus tag: NWMN_RS02570 ]
  • symbol: NWMN_0451
  • description: hypothetical protein
  • length: 241
  • theoretical pI: 7.10892
  • theoretical MW: 28096.3
  • GRAVY: -0.438589

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 45.6)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 37.6)
    and 7 more
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 36.4)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 23.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 14.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 12.9)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 12.7)
    Metabolism Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 11.8)
  • TheSEED:  
    Stress Response Heat shock Heat shock dnaK gene cluster extended  COG4123: Predicted O-methyltransferase
  • PFAM:
    NADP_Rossmann (CL0063) MTS; Methyltransferase small domain (PF05175; HMM-score: 56.8)
    and 11 more
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 33.5)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 24.9)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 20.5)
    UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 19.6)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 18.4)
    Methyltransf_10; Protein of unknown function (DUF890) (PF05971; HMM-score: 18.3)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 18.3)
    N6-adenineMlase; Probable N6-adenine methyltransferase (PF10237; HMM-score: 17.3)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 17.1)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 14.8)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 13.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00241
    • TAT(Tat/SPI): 0.000678
    • LIPO(Sec/SPII): 0.000779
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLLFAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNPPYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRAERLMDVLFEMRKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKEVYYG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • NWMN_0451 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]