From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
  • pan locus tag?: SAUPAN002302000
  • symbol: NWMN_0496
  • pan gene symbol?: sigH
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
  • symbol: NWMN_0496
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 570767..571336
  • length: 570
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAATACGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATGCAATAAATGAT
    AAAGACTTCGAAAAGTTAGTAATGGATCTACAACCATTAATTATTCGACGCATCAAAACA
    TTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAGAAATACTTATACGGATGTAT
    AGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
    TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATG
    GATAATTTGATTAATGAATATAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTT
    GAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGATTTGTCAGTTTAAGTATTTG
    AGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
    GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAAT
    AAAATAAAACGTTATTTCAAAATGATTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
  • symbol: NWMN_0496
  • description: hypothetical protein
  • length: 189
  • theoretical pI: 9.43118
  • theoretical MW: 23028.8
  • GRAVY: -0.478836

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 53.2)
    and 17 more
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 29)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 25.2)
    RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 25.1)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 25.1)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 21)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 19.9)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 19.8)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.4)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 16.4)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 12.9)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 42.7)
    and 7 more
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 16.1)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 14.6)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 13.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.4)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.9)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 11.8)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by SigH*, sigma factor, controlling competence and phage integrase genes: in N315, NCTC8325

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001521
    • TAT(Tat/SPI): 0.000208
    • LIPO(Sec/SPII): 0.000353
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKNKIKRYFKMI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
Genes Cells: 2003, 8(8);699-712
[PubMed:12875655] [WorldCat.org] [DOI] (P p)
Liang Tao, Xiaoqian Wu, Baolin Sun
Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
PLoS Pathog: 2010, 6(5);e1000888
[PubMed:20485515] [WorldCat.org] [DOI] (I e)
Kazuya Morikawa, Aya J Takemura, Yumiko Inose, Melody Tsai, Le Thuy Nguyen Thi, Toshiko Ohta, Tarek Msadek
Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus.
PLoS Pathog: 2012, 8(11);e1003003
[PubMed:23133387] [WorldCat.org] [DOI] (I p)