Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0751
- pan locus tag?: SAUPAN002769000
- symbol: NWMN_0751
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0751
- symbol: NWMN_0751
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 845805..845999
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5331646 NCBI
- RefSeq: YP_001331785 NCBI
- BioCyc:
- MicrobesOnline: 3706300 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGCAAATTATAAAAACTAAAAATTCCAAAAAGAGTTTATCATCCAAAACAATAAAAATG
GCTACAATGGTATGTTGTGAAATGCATTTCTTAACTACGACTTCTTTTATTTCCGTCTCG
TCAACTATTGCTGATTGTGTTAATAGGCATATTGATTCTAATGAAAATATCAAAACTCGG
CTCATCTCTTTATAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0751
- symbol: NWMN_0751
- description: hypothetical protein
- length: 64
- theoretical pI: 10.0723
- theoretical MW: 7180.46
- GRAVY: 0.0046875
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0056
- Cytoplasmic Membrane Score: 0.0021
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.9922
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.5
- Signal peptide possibility: 0
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide SP(Sec/SPI) length 44 aa
- SP(Sec/SPI): 0.508752
- TAT(Tat/SPI): 0.007925
- LIPO(Sec/SPII): 0.031978
- Cleavage Site: CS pos: 44-45. TIA-DC. Pr: 0.3404
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQIIKTKNSKKSLSSKTIKMATMVCCEMHFLTTTSFISVSSTIADCVNRHIDSNENIKTRLISL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.