Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0889 [new locus tag: NWMN_RS04975 ]
- pan locus tag?: SAUPAN003197000
- symbol: NWMN_0889
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0889 [new locus tag: NWMN_RS04975 ]
- symbol: NWMN_0889
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 986729..986992
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332178 NCBI
- RefSeq: YP_001331923 NCBI
- BioCyc:
- MicrobesOnline: 3706438 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGGTGGCCCTGTTGATTAATAAAAGATTTATTGATGAAGGTAAAACTATTGATGTTTAT
TTATTCGAAGCATTAAATAACCAGATAATCATTGCTATACCAGATTGGTTTTGGTCATAT
CAGATGGCAATGACATTAGATGAAGAAACTTGTTTTGAAGCAATACTCATGCAATTGTTT
GTTTTTAAAGAAGAGGAAGAGGCAGAATCGATTGCATCACAACTAACAGATTGGATAGAA
ACATATAAAAAGGAGAAAGACTAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0889 [new locus tag: NWMN_RS04975 ]
- symbol: NWMN_0889
- description: hypothetical protein
- length: 87
- theoretical pI: 3.87053
- theoretical MW: 10349.8
- GRAVY: -0.0275862
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: FIG01108336: hypothetical protein
- PFAM: no clan defined YueH; YueH-like protein (PF14166; HMM-score: 96.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000719
- TAT(Tat/SPI): 0.000049
- LIPO(Sec/SPII): 0.000163
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVALLINKRFIDEGKTIDVYLFEALNNQIIIAIPDWFWSYQMAMTLDEETCFEAILMQLFVFKEEEEAESIASQLTDWIETYKKEKD
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: murE > NWMN_0889 > prfC
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]