Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1027 [new locus tag: NWMN_RS05815 ]
- pan locus tag?: SAUPAN001694000
- symbol: NWMN_1027
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1027 [new locus tag: NWMN_RS05815 ]
- symbol: NWMN_1027
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1124470..1124814
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330631 NCBI
- RefSeq: YP_001332061 NCBI
- BioCyc:
- MicrobesOnline: 3706578 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAACACTTGGTATTACAGATTTAAATGTTATTGAGCAAATGACATTAACAGAATAT
AACTATCGAATGTATGCGAAAGAGTATGAAATGCTAACCCAAGAATTCGAACGTTACAAA
CTTGCGTTTGCTATTCGTGATGCTGCAGCTACTAAAAATGTTGGGACAGAAAATAAACCT
AAAGAGGAATATGTTTTTAACAACGCAAACGACGTATTGCCTTATGAAGAAAATATCCAA
CGGCTTAACGAAGGTAAAGATATAAGATTTAGTAGCGAACGTGATGAATACGAACCACAA
AATAATGAATTCTTTAAAGTTATAGCAGAATTTAACAAGCAATAG60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1027 [new locus tag: NWMN_RS05815 ]
- symbol: NWMN_1027
- description: hypothetical protein
- length: 114
- theoretical pI: 4.31397
- theoretical MW: 13588
- GRAVY: -0.896491
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage phi 11 orf41 protein homolog
- PFAM: no clan defined Yqai; Hypothetical protein Yqai (PF09466; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9038
- Cytoplasmic Membrane Score: 0.0511
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0443
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.0059
- TAT(Tat/SPI): 0.000844
- LIPO(Sec/SPII): 0.000536
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSTLGITDLNVIEQMTLTEYNYRMYAKEYEMLTQEFERYKLAFAIRDAAATKNVGTENKPKEEYVFNNANDVLPYEENIQRLNEGKDIRFSSERDEYEPQNNEFFKVIAEFNKQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: NWMN_1018 > NWMN_1019 > NWMN_1020 > NWMN_1021 > NWMN_1022 > NWMN_1023 > NWMN_1024 > NWMN_1025 > NWMN_1026 > NWMN_1027 > NWMN_1028 > NWMN_1029 > NWMN_1030 > NWMN_1031 > NWMN_1032 > NWMN_1033
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]