Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1059
- pan locus tag?: SAUPAN003386000
- symbol: NWMN_1059
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1059
- symbol: NWMN_1059
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1164304..1164453
- length: 150
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5332590 NCBI
- RefSeq: YP_001332093 NCBI
- BioCyc:
- MicrobesOnline: 3706610 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGAAAGTTTATCATCACAAGCAATTTTAAATATCGAATCCAAATGTTACATTGTTCG
ACATGCAGTTTGGTGATCGTGCAGTGTGTATTTGTCTTTAAAATGTTTCGCTTAATGATA
ATGACAACGCTAGAAACGATATCACTTTAG60
120
150
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1059
- symbol: NWMN_1059
- description: hypothetical protein
- length: 49
- theoretical pI: 10.1513
- theoretical MW: 5867.28
- GRAVY: 0.885714
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8197
- Cytoplasmic Membrane Score: 0.0156
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1647
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029611
- TAT(Tat/SPI): 0.000568
- LIPO(Sec/SPII): 0.233433
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRKFIITSNFKYRIQMLHCSTCSLVIVQCVFVFKMFRLMIMTTLETISL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.