Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1255 [new locus tag: NWMN_RS07085 ]
- pan locus tag?: SAUPAN003718000
- symbol: NWMN_1255
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1255 [new locus tag: NWMN_RS07085 ]
- symbol: NWMN_1255
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1378727..1379017
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332546 NCBI
- RefSeq: YP_001332289 NCBI
- BioCyc:
- MicrobesOnline: 3706807 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGATGAATTTAGTAAAATTCAGTAGGATAAAGAAAGCGGGTGAAACAATGGCAACTTGG
TTAGCAATTATTTTTATAGTAGCTGCATTAATTTTAGGTTTAATTGGAGGTTTCCTTTTA
GCTAGAAAATATATGATGGACTACTTGAAGAAAAACCCACCAATCAACGAAGAAATGCTT
CGTATGATGATGATGCAAATGGGTCAAAAACCTTCTCAGAAGAAAATTAATCAAATGATG
ACGATGATGAATAAAAATATGGATCAAAATATGAAGAGTGCGAAAAAGTAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1255 [new locus tag: NWMN_RS07085 ]
- symbol: NWMN_1255
- description: hypothetical protein
- length: 96
- theoretical pI: 11.0213
- theoretical MW: 11154.8
- GRAVY: -0.06875
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 14.5)
- TheSEED :
- UPF0154 protein YneF
- PFAM: no clan defined UPF0154; Uncharacterised protein family (UPF0154) (PF03672; HMM-score: 102)and 2 moreCATSPERE_NTD2; CATSPERE second N-terminal domain (PF22843; HMM-score: 15.8)E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 14.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9906
- Cell wall & surface Score: 0
- Extracellular Score: 0.0093
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006376
- TAT(Tat/SPI): 0.000452
- LIPO(Sec/SPII): 0.002688
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMNLVKFSRIKKAGETMATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]