Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
- pan locus tag?: SAUPAN004227000
- symbol: NWMN_1527
- pan gene symbol?: csbD
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
- symbol: NWMN_1527
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1692649..1692831
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330913 NCBI
- RefSeq: YP_001332561 NCBI
- BioCyc:
- MicrobesOnline: 3707079 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCAGACGAAAGTAAGTTCGATCAATTTAAAGGAAATGTTAAAGAAACAGTAGGTAAC
GTTACTGATAACAAAGAATTAGAAAAAGAAGGTCAGCAAGATAAAGTGATTGGTAAAGCA
AAAGAAGTTGTTGAAAATGCTAAAAACAAAATAACTGATGCAATTGATAAACTTAAAAAA
TAA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
- symbol: NWMN_1527
- description: hypothetical protein
- length: 60
- theoretical pI: 6.85884
- theoretical MW: 6722.53
- GRAVY: -1.12833
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: sigmaB-controlled gene product
- PFAM: YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 56.3)and 3 moreno clan defined TBCA; Tubulin binding cofactor A (PF02970; HMM-score: 17.4)MT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 13.2)YtxH; YtxH-like protein (PF12732; HMM-score: 12.3)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010269
- TAT(Tat/SPI): 0.002049
- LIPO(Sec/SPII): 0.003958
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation [1] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)
⊟Relevant publications[edit | edit source]