From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1535 [new locus tag: NWMN_RS08615 ]
  • pan locus tag?: SAUPAN004238000
  • symbol: NWMN_1535
  • pan gene symbol?: dtd
  • synonym:
  • product: D-tyrosyl-tRNA(Tyr) deacylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1535 [new locus tag: NWMN_RS08615 ]
  • symbol: NWMN_1535
  • product: D-tyrosyl-tRNA(Tyr) deacylase
  • replicon: chromosome
  • strand: -
  • coordinates: 1700484..1700936
  • length: 453
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGTAGTTGTACAAAGAGTTAAAGAAGCATCGGTGACGAATGATACATTAAATAAT
    CAAATCAAAAAAGGATATTGTTTATTAGTCGGTATCGGTCAGAACTCTACAGAGCAAGAT
    GCAGATGTAATTGCAAAGAAAATTGCTAATGCAAGATTATTTGAAGATGACAATAATAAA
    TTAAACTTTAATATCCAACAAATGAATGGTGAAATACTATCAGTTTCACAATTTACTCTC
    TATGCAGATGTAAAAAAAGGTAACCGTCCAGGTTTCTCAAATTCTAAAAATCCTGATCAA
    GCGGTAAAAATTTATGAGTATTTTAATGATGCGCTACGAGCGTATGGTCTTACTGTGAAA
    ACAGGTGAATTTGGAACACACATGAATGTTAGCATAAATAATGATGGTCCAGTCACTATT
    ATTTATGAAAGTCAGGACGGCAAAATTCAATGA
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1535 [new locus tag: NWMN_RS08615 ]
  • symbol: NWMN_1535
  • description: D-tyrosyl-tRNA(Tyr) deacylase
  • length: 150
  • theoretical pI: 7.34423
  • theoretical MW: 16696.7
  • GRAVY: -0.502667

Function[edit | edit source]

  • reaction:
    EC 3.1.1.96?  ExPASy
    D-aminoacyl-tRNA deacylase A D-aminoacyl-tRNA + H2O = a D-amino acid + tRNA Glycyl-tRNA(Ala) + H2O = glycine + tRNA(Ala)?
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA aminoacylation D-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 175.4)
  • TheSEED:  
    Clustering-based subsystems D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-) cluster CBSS-342610.3.peg.283  D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)
    and 2 more
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Stringent Response, (p)ppGpp metabolism  D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)
    Stress Response Detoxification D-tyrosyl-tRNA(Tyr) deacylase  D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)
  • PFAM:
    no clan defined Tyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 171.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.027251
    • TAT(Tat/SPI): 0.000323
    • LIPO(Sec/SPII): 0.002547
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKVVVQRVKEASVTNDTLNNQIKKGYCLLVGIGQNSTEQDADVIAKKIANARLFEDDNNKLNFNIQQMNGEILSVSQFTLYADVKKGNRPGFSNSKNPDQAVKIYEYFNDALRAYGLTVKTGEFGTHMNVSINNDGPVTIIYESQDGKIQ

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]