Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1547 [new locus tag: NWMN_RS08675 ]
- pan locus tag?: SAUPAN004251000
- symbol: rpmA
- pan gene symbol?: rpmA
- synonym:
- product: 50S ribosomal protein L27
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1547 [new locus tag: NWMN_RS08675 ]
- symbol: rpmA
- product: 50S ribosomal protein L27
- replicon: chromosome
- strand: -
- coordinates: 1715370..1715654
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332217 NCBI
- RefSeq: YP_001332581 NCBI
- BioCyc:
- MicrobesOnline: 3707099 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTAAAATTAAACTTACAATTCTTCGCATCTAAAAAAGGGGTAAGTTCTACAAAAAAC
GGACGTGACTCTGAATCAAAACGCTTAGGTGCTAAACGTGCTGACGGTCAATTCGTAACA
GGTGGTTCAATTTTATATCGCCAACGTGGTACTAAAATTTACCCTGGTGAAAATGTAGGT
CGTGGTGGCGATGATACATTATTCGCTAAAATCGACGGCGTTGTTAAATTCGAACGTAAA
GGTCGCGACAAAAAACAAGTTTCTGTATATGCAGTAGCTGAATAA60
120
180
240
285
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: NWMN_1547 [new locus tag: NWMN_RS08675 ]
- symbol: RpmA
- description: 50S ribosomal protein L27
- length: 94
- theoretical pI: 10.8424
- theoretical MW: 10314.7
- GRAVY: -0.689362
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL27 (TIGR00062; HMM-score: 132.7)
- TheSEED :
- LSU ribosomal protein L27p
- PFAM: no clan defined Ribosomal_L27; Ribosomal L27 protein (PF01016; HMM-score: 119.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7651
- Cytoplasmic Membrane Score: 0.0033
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.2314
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021947
- TAT(Tat/SPI): 0.003805
- LIPO(Sec/SPII): 0.0037
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rpmA < NWMN_1548 < rplU
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]