Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1861 [new locus tag: NWMN_RS10695 ]
- pan locus tag?: SAUPAN004972000
- symbol: NWMN_1861
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1861 [new locus tag: NWMN_RS10695 ]
- symbol: NWMN_1861
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2075001..2075174
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331130 NCBI
- RefSeq: YP_001332895 NCBI
- BioCyc:
- MicrobesOnline: 3707449 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACA
TTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGAT
ATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1861 [new locus tag: NWMN_RS10695 ]
- symbol: NWMN_1861
- description: hypothetical protein
- length: 57
- theoretical pI: 8.49847
- theoretical MW: 6564.7
- GRAVY: 0.445614
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
- TheSEED :
- FIG01108203: hypothetical protein
- PFAM: no clan defined FixS; Cytochrome oxidase maturation protein cbb3-type (PF03597; HMM-score: 16.3)and 1 moreDUF3918; Protein of unknown function (DUF3918) (PF13056; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0005
- Cytoplasmic Membrane Score: 0.4646
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.5348
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.384612
- TAT(Tat/SPI): 0.007845
- LIPO(Sec/SPII): 0.041173
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [1] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)