Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1934 [new locus tag: NWMN_RS11155 ]
- pan locus tag?: SAUPAN005240000
- symbol: NWMN_1934
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1934 [new locus tag: NWMN_RS11155 ]
- symbol: NWMN_1934
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2142151..2142588
- length: 438
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331195 NCBI
- RefSeq: YP_001332968 NCBI
- BioCyc:
- MicrobesOnline: 3707522 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGTTTATTTCTCTAGCTATTTGGTCAATAAATTCGATGGGTAATAAACAATGCATTAGT
TTGAATTTATTGCTTTCGGATGATACTTTCGCAGTAATTTCAGTAATGACAACTTTGGGA
ACTGCTATTTTAGGAGGTATAGCACCTTCAATATATGGTATTTTTACATCGCCTATAGAT
AAAAAAAGTAGTTTTAGGGCTATTAGCGATTGGGAGCAAGAACAAAGAAATAATGTTAAA
GATCTGATGATGCTATTACCATTTACATTACTTAGTATTTTAATTGTGATTTTTATTTTT
CAGTTTGCATATTCTAAACTATTTAATACGATAGCTATTATAATATTTATTATAATACTT
GTTGTTATGTTTTTTTTAATTTTATTAATCTGTTATAAAATTACTGTGAAGATATGCAGA
TATTTTTCAAAAGAATAG60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1934 [new locus tag: NWMN_RS11155 ]
- symbol: NWMN_1934
- description: hypothetical protein
- length: 145
- theoretical pI: 8.84397
- theoretical MW: 16481.8
- GRAVY: 0.995862
⊟Function[edit | edit source]
- TIGRFAM: MSEP-CTERM protein (TIGR04286; HMM-score: 10.2)
- TheSEED :
- FIG01108895: hypothetical protein
- PFAM: no clan defined EIID-AGA; PTS system mannose/fructose/sorbose family IID component (PF03613; HMM-score: 15.4)MscS_TM; Mechanosensitive ion channel inner membrane domain 1 (PF12794; HMM-score: 13.9)DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 12.6)TRP; Transient receptor potential (TRP) ion channel (PF06011; HMM-score: 12.5)and 5 moreVirul_fac_BrkB; Virulence factor BrkB (PF03631; HMM-score: 11.9)DUF3043; Protein of unknown function (DUF3043) (PF11241; HMM-score: 10.8)Ac76; Orf76 (Ac76) (PF05814; HMM-score: 9.2)DUF6480; Family of unknown function (DUF6480) (PF20088; HMM-score: 8.9)DUF6366; Family of unknown function (DUF6366) (PF19893; HMM-score: 8.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9465
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.053
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.039755
- TAT(Tat/SPI): 0.001271
- LIPO(Sec/SPII): 0.002709
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFISLAIWSINSMGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWEQEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNTIAIIIFIIILVVMFFLILLICYKITVKICRYFSKE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [1] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)