Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2216 [new locus tag: NWMN_RS12780 ]
- pan locus tag?: SAUPAN005793000
- symbol: NWMN_2216
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2216 [new locus tag: NWMN_RS12780 ]
- symbol: NWMN_2216
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2437450..2437779
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331340 NCBI
- RefSeq: YP_001333250 NCBI
- BioCyc:
- MicrobesOnline: 3707818 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATAAACGAAACTAAGTATATGAGACAACAAATTACTAATTTGATTCAAATCATTGAT
ACGATTAAATATAATACTTTAATGACAGATTGGAACATTCAAACGCATATTTATAAATTT
AACCAAATAGTTACTAATGAATTGAATAAGTTCAAAGGCTTTGAAACATCATATATAATA
AACGAAAATCAAGTTTCCTATTATGAAATTATAACACTACTTAATAAACGTCCCCTCCGA
CAAGTCGACTATGGTAACAAAATTCAATATCTTAATTTTTATCATACAGAACTATCTAAC
GCATTATTTGCAATTAAATTTGCCCATTAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2216 [new locus tag: NWMN_RS12780 ]
- symbol: NWMN_2216
- description: hypothetical protein
- length: 109
- theoretical pI: 9.20097
- theoretical MW: 13193
- GRAVY: -0.380734
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4536
- Cytoplasmic Membrane Score: 0.0122
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.534
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00532
- TAT(Tat/SPI): 0.000095
- LIPO(Sec/SPII): 0.000696
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MINETKYMRQQITNLIQIIDTIKYNTLMTDWNIQTHIYKFNQIVTNELNKFKGFETSYIINENQVSYYEIITLLNKRPLRQVDYGNKIQYLNFYHTELSNALFAIKFAH
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]