Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2283 [new locus tag: NWMN_RS13140 ]
- pan locus tag?: SAUPAN005909000
- symbol: NWMN_2283
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2283 [new locus tag: NWMN_RS13140 ]
- symbol: NWMN_2283
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2509121..2509477
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331397 NCBI
- RefSeq: YP_001333317 NCBI
- BioCyc:
- MicrobesOnline: 3707885 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAGAAAAAAGGTTTTGGTCTTGGTATTAGTTTAATCGCCATCATGTTAATTGTA
TGTATTGTATTAGTAATCATGATGATGACTGGCGGAAAGAAAGATACATACTATGGAATT
ATGAAAGATAATACTACTATTGAAAAAATGATTAGTGAAAAAGATGAAAGTATTGAAAAA
AATGTTAAATTACCTTCAGATTCAGATGTTAAAGTTAAAAAAGGTGATTTTGTAATTGTT
TATAAATTAGCAGATTCAGATAAAATTGTTAAAGTTAAAAAAGTTGACCATGACGATGTA
CCACATGGTTTAATGATGAAAATTCATGACATGGGCAAAATGCACATGAAACACTAA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2283 [new locus tag: NWMN_RS13140 ]
- symbol: NWMN_2283
- description: hypothetical protein
- length: 118
- theoretical pI: 9.96512
- theoretical MW: 13340.1
- GRAVY: -0.111017
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108504: hypothetical protein
- PFAM: no clan defined DUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 135.6)and 2 moreNusG_II; NusG domain II (PF07009; HMM-score: 15.8)UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9039
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0956
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.096205
- TAT(Tat/SPI): 0.000587
- LIPO(Sec/SPII): 0.210827
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEKNVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]